Tech News
All News AI & ML Architecture DevOps Open Source Programming Team Management Testing & QA Web

Architecture

⚑ Report a Problem

Latest Architecture news from Tech News

All topics agents ai api architecture automation aws backend beginners career database devchallenge devops discuss javascript llm machinelearning mcp opensource performance productivity programming python react security showdev softwareengineering systemdesign tutorial typescript webdev
All EN RU
EN

Data Consistency in Microservices — Saga Pattern

One-liner: In microservices, you can't use a single database transaction across services — the Saga pattern breaks it into a sequence of local transac…

systemdesigndevopsbackendmicroservices
Dev.to Aug 1, 2026, 02:00 UTC
EN

Building Production AI Systems(Final)

Designing AI Systems That Outlive Today's Models If there's one lesson this series has taught me, it's this: Don't build your application around a mod…

aiarchitecturellmsystemdesign
Dev.to Jul 31, 2026, 06:15 UTC
EN

LLD Data Structures in Design Context: Real-World HashMaps — Sessions, Caches, Indexes and Design Trade-offs

"A HashMap is not valuable because it is fast. It is valuable because it makes the right things fast." In the previous articles, we built our understa…

lldsystemdesignsoftwareengineeringcodinginterview
Dev.to Jul 30, 2026, 17:30 UTC
EN

The Day the Warehouse Burned: Lessons in Cross-Border System Resilience

A fire in a fulfillment center on the far side of the world. It didn't make headlines. But for a cross-border e-commerce operation, it was a quiet cat…

architectureinfrastructurescalabilitysystemdesign
Dev.to Jul 29, 2026, 02:42 UTC
EN

How to Destroy a Project in 5 Steps

The following guide is provided as a public service. If your goal is to maximize chaos, ensure total loss of accountability, and achieve legendary sta…

devopsdistributedsystemssystemdesignarchitecture
Dev.to Jul 28, 2026, 14:05 UTC
EN

From Payment to Shipping: How We Built a Cross-Border Order State Machine That Solved Idempotency and Callback Chaos

When your payment gateway fires the same "paid" webhook three times, your logistics API calls back with "shipped" before payment is confirmed, and the…

architecturebackendsoftwareengineeringsystemdesign
Dev.to Jul 28, 2026, 07:00 UTC
EN

When to refactor vs rewrite

A decision tree for grown engineers Every engineering team eventually faces the same dramatic sentence. We should just rewrite this. It is usually sai…

bestpracticessystemdesignwebdevprogramming
Dev.to Jul 27, 2026, 19:56 UTC
EN

Building Microservices Like a Professional: Lessons I Wish I Learned Earlier

If you've ever started a microservices project by splitting a monolith into dozens of tiny services, you've probably experienced this: "We have micros…

architecturemicroservicessoftwareengineeringsystemdesign
Dev.to Jul 27, 2026, 04:54 UTC
EN

Stop Using Round-Robin: High-Throughput Java Virtual Thread Routing with P2C

Stop Using Round-Robin: High-Throughput Java Virtual Thread Routing with P2C Virtual threads allow Java microservices to comfortably run 50,000 concur…

javaconcurrencysystemdesignalgorithms
Dev.to Jul 26, 2026, 05:46 UTC
EN

Beyond the Model: Building the AI Harness

The AI Harness is becoming the real engineering layer. Everyone is talking about AI Agents. I think we're missing the more important piece. The AI Har…

aiarchitecturellmsystemdesign
Dev.to Jul 25, 2026, 13:33 UTC
EN

I Found the LeetCode for System Design Interview, and It's Awesome

Disclosure: This post includes affiliate links; I may receive compensation if you purchase products or services from the different links provided in t…

systemdesignleetcodeprogrammingcodinginterview
Dev.to Jul 25, 2026, 09:08 UTC
EN

The Follow-Up Questions That Decide System Design Interviews (And How to Pre-Empt Them)

Where Interviews Are Actually Won Ask interviewers where candidates separate, and almost none will say "the initial design." Prep materials have conve…

systemdesigninterviewdesigninterviewsystemdesigninterviewquestions
Dev.to Jul 25, 2026, 07:47 UTC
EN

What actually belongs in an architecture decision record (and what doesn't)

Most architecture decision records fail for the opposite reason people think. The issue usually isn't that teams forget to write them. It's that the o…

architecturesoftwaredesignsystemdesign
Dev.to Jul 25, 2026, 06:35 UTC
EN

trelix v2.7 to v2.9: The Release Where the Pipeline Itself Became the Product

On 2026-07-09 I shipped trelix v2.7.0. The architecture felt done — seven retrieval legs, a knowledge graph, an agentic loop. Then I opened the GitHub…

systemdesigndevopspythonobservability
Dev.to Jul 24, 2026, 16:44 UTC
EN

Polling: When "Simple" Starts Sending Millions of Requests

Imagine you're building a SaaS platform. Nothing fancy. Just a notification bell in the top-right corner. When someone receives a new message, complet…

backendsystemdesignscalabilityarchitecture
Dev.to Jul 24, 2026, 15:40 UTC
EN

The Backend Patterns I Wish I Learned Earlier

When I started building backend systems, I thought becoming a better developer meant learning more technologies. A new framework. A new database. A ne…

architecturebackendsoftwareengineeringsystemdesign
Dev.to Jul 23, 2026, 08:39 UTC
EN

Designing Software That Gets Faster as It Gets Bigger

One of the biggest myths in software engineering is that growth inevitably makes software slower. We almost expect it. More users mean more database q…

architectureperformancesystemdesign
Dev.to Jul 23, 2026, 08:03 UTC
EN

Why your Cache won't save you from a "Thundering Herd" 🐂

We've all been there: you add Redis, and your latency drops. But have you planned for the Thundering Herd? The Problem A Thundering Herd occurs when a…

systemdesignbackendprogrammingarchitecture
Dev.to Jul 22, 2026, 19:29 UTC
EN

Designing a Notification System That Doesn't Fall Apart

Every application eventually reaches the point where it needs notifications. At first, it feels simple. A user signs up? Send an email. Someone likes …

architecturebackendscalabilitysystemdesign
Dev.to Jul 22, 2026, 16:35 UTC
EN

Building Reliable Event-Driven Systems: Event Schemas, Versioning, Contract Testing and Events vs Commands (5/5)

In this final article, we're going to explore Production practices 22. Events Are Delivered, Not Guaranteed A common misconception in event-driven arc…

eventdrivendistributedsystemssystemdesigntutorial
Dev.to Jul 22, 2026, 08:50 UTC
EN

Shared Context Patterns for Multi-Agent Systems

You've got three agents running at the same time. One pulls customer data. Another generates a response. The third decides whether to escalate. Then a…

agentsaiarchitecturesystemdesign
Dev.to Jul 22, 2026, 07:58 UTC
EN

How We Split a Legacy Monolith Into Microservices Without a Single Outage

8 min read · telecom provisioning platform, 30M+ subscribers Most companies avoid migrating their monolith for one reason: they imagine it as a single…

microservicessystemdesigntechleadershiparchitecture
Dev.to Jul 20, 2026, 15:48 UTC
EN

Reversal Architecture in Distributed Financial Systems: Compensation, Liability, and Irreversible Side Effects

Abstract Distributed financial systems frequently treat reversal as a secondary state attached to an otherwise completed transaction. A payment succee…

distributedsystemsfintechsystemdesignfinancialinfrastructure
Dev.to Jul 19, 2026, 16:05 UTC
EN

We fixed a hidden bug in a system processing 10M+ messages a day.

9 min read · warehouse execution system, global retail & manufacturing A few years ago I worked on a warehouse execution system (WES) — the softwa…

enterprisesystemdesignbackendengineeringtechleadership
Dev.to Jul 19, 2026, 16:03 UTC
EN

System Design - Building an Experiment Service

So I tried to build an experiment service (here's every wrong turn first) Say you run a website and have a hunch a new signup page converts better tha…

architecturesoftwareengineeringsystemdesigntesting
Dev.to Jul 19, 2026, 10:05 UTC
EN

How Netflix Doesn't Crash During Peak Hours (Cloud Concepts) ! 😱

Millions of people open Netflix at the same time—during weekends, evenings, or when a new season drops. Despite this massive traffic, users usually ex…

cloudcomputingawssystemdesignbackend
Dev.to Jul 19, 2026, 07:29 UTC
EN

LLD Domain Modeling: The Only Cheat Sheet You Actually Need (Interview + Real System Design)

After going through entities, invariants, state machines, aggregates, bounded contexts, and full systems like Ride Sharing, BookMyShow, and Amazon Car…

lldsystemdesignsoftwareengineeringcodinginterview
Dev.to Jul 18, 2026, 18:00 UTC
EN

LLD Domain Modeling: The Complete Mental Framework (How to Think in Any System Design Problem)

This is the final consolidation of everything in Domain Modeling. If you understand this structure deeply, you don’t need to memorize LLD patterns any…

lldsystemdesignsoftwareengineeringcodinginterview
Dev.to Jul 18, 2026, 17:00 UTC
EN

LLD Domain Modeling: How Real Systems Evolve Over Time (Versioning, Change & Refactoring Reality)

One thing beginner LLD tutorials rarely show is this: real systems never stay in their “initial design”. They evolve constantly: new features get adde…

lldsystemdesignsoftwareengineeringcodinginterview
Dev.to Jul 18, 2026, 16:00 UTC
EN

LLD Domain Modeling: When NOT to Use Domain Modeling (Very Important Reality Check)

Up to now, domain modeling may feel like the answer to everything: entities aggregates invariants bounded contexts state machines But strong engineers…

lldsystemdesignsoftwareengineeringcodinginterview
Dev.to Jul 18, 2026, 15:00 UTC

© Tech News — Headline Aggregator

Sitemap Legal Notice Privacy Terms Copyright / Removal DSA Contact

Leaving the site

You are about to open an external website:

Continue →