Tech News
All News AI & ML Architecture DevOps Open Source Programming Team Management Testing & QA Web

Testing & QA

⚑ Report a Problem

Latest Testing & QA news from Tech News

All topics agents ai api architecture automation aws backend beginners career claude cybersecurity database devchallenge devops javascript llm machinelearning mcp opensource performance productivity programming python security showdev softwareengineering testing tutorial typescript webdev
All EN RU
EN

Messages Need a Protocol Before They Need a Chat UI

A patient taps a kiosk and asks for help. A staff member replies from another screen. The same message may appear in the app, trigger a push notificat…

messaginghealthcaretypescriptsystemdesign
Dev.to Jul 31, 2026, 20:07 UTC
EN

Building Production AI Systems(Final)

Designing AI Systems That Outlive Today's Models If there's one lesson this series has taught me, it's this: Don't build your application around a mod…

aiarchitecturellmsystemdesign
Dev.to Jul 31, 2026, 06:15 UTC
EN

LLD Data Structures in Design Context: Why HashMaps Feel So Fast — Understanding Performance Without Memorising Big-O

"A HashMap feels fast not because computers became magically faster. It feels fast because the design avoids doing unnecessary work." In the previous …

lldsystemdesignsoftwareengineeringcodinginterview
Dev.to Jul 30, 2026, 16:30 UTC
EN

LLD Data Structures in Design Context: Why Modern Software Needs Fast Lookup Before Anything Else

"The biggest challenge in large software systems isn't storing information. It's finding the right information instantly." By now we've established tw…

lldsystemdesignsoftwareengineeringcodinginterview
Dev.to Jul 29, 2026, 16:30 UTC
EN

The Day the Warehouse Burned: Lessons in Cross-Border System Resilience

A fire in a fulfillment center on the far side of the world. It didn't make headlines. But for a cross-border e-commerce operation, it was a quiet cat…

architectureinfrastructurescalabilitysystemdesign
Dev.to Jul 29, 2026, 02:42 UTC
EN

When to refactor vs rewrite

A decision tree for grown engineers Every engineering team eventually faces the same dramatic sentence. We should just rewrite this. It is usually sai…

bestpracticessystemdesignwebdevprogramming
Dev.to Jul 27, 2026, 19:56 UTC
EN

Building Microservices Like a Professional: Lessons I Wish I Learned Earlier

If you've ever started a microservices project by splitting a monolith into dozens of tiny services, you've probably experienced this: "We have micros…

architecturemicroservicessoftwareengineeringsystemdesign
Dev.to Jul 27, 2026, 04:54 UTC
EN

I Found the LeetCode for System Design Interview, and It's Awesome

Disclosure: This post includes affiliate links; I may receive compensation if you purchase products or services from the different links provided in t…

systemdesignleetcodeprogrammingcodinginterview
Dev.to Jul 25, 2026, 09:08 UTC
EN

The Follow-Up Questions That Decide System Design Interviews (And How to Pre-Empt Them)

Where Interviews Are Actually Won Ask interviewers where candidates separate, and almost none will say "the initial design." Prep materials have conve…

systemdesigninterviewdesigninterviewsystemdesigninterviewquestions
Dev.to Jul 25, 2026, 07:47 UTC
EN

trelix v2.7 to v2.9: The Release Where the Pipeline Itself Became the Product

On 2026-07-09 I shipped trelix v2.7.0. The architecture felt done — seven retrieval legs, a knowledge graph, an agentic loop. Then I opened the GitHub…

systemdesigndevopspythonobservability
Dev.to Jul 24, 2026, 16:44 UTC
EN

The Backend Patterns I Wish I Learned Earlier

When I started building backend systems, I thought becoming a better developer meant learning more technologies. A new framework. A new database. A ne…

architecturebackendsoftwareengineeringsystemdesign
Dev.to Jul 23, 2026, 08:39 UTC
EN

Building Reliable Event-Driven Systems: Event Schemas, Versioning, Contract Testing and Events vs Commands (5/5)

In this final article, we're going to explore Production practices 22. Events Are Delivered, Not Guaranteed A common misconception in event-driven arc…

eventdrivendistributedsystemssystemdesigntutorial
Dev.to Jul 22, 2026, 08:50 UTC
EN

How We Split a Legacy Monolith Into Microservices Without a Single Outage

8 min read · telecom provisioning platform, 30M+ subscribers Most companies avoid migrating their monolith for one reason: they imagine it as a single…

microservicessystemdesigntechleadershiparchitecture
Dev.to Jul 20, 2026, 15:48 UTC
EN

Building Reliable Event-Driven Systems: Event Schemas, Versioning, Contract Testing and Events vs Commands (part-4)

In this article, we're going to explore Contract Testing Contract testing ensures that event contracts remain stable as systems evolve. Producers rece…

eventdrivendistributedsystemssystemdesigntutorial
Dev.to Jul 20, 2026, 09:00 UTC
EN

System Design - Building an Experiment Service

So I tried to build an experiment service (here's every wrong turn first) Say you run a website and have a hunch a new signup page converts better tha…

architecturesoftwareengineeringsystemdesigntesting
Dev.to Jul 19, 2026, 10:05 UTC
EN

LLD Domain Modeling: The Only Cheat Sheet You Actually Need (Interview + Real System Design)

After going through entities, invariants, state machines, aggregates, bounded contexts, and full systems like Ride Sharing, BookMyShow, and Amazon Car…

lldsystemdesignsoftwareengineeringcodinginterview
Dev.to Jul 18, 2026, 18:00 UTC
EN

LLD Domain Modeling: How Real Systems Evolve Over Time (Versioning, Change & Refactoring Reality)

One thing beginner LLD tutorials rarely show is this: real systems never stay in their “initial design”. They evolve constantly: new features get adde…

lldsystemdesignsoftwareengineeringcodinginterview
Dev.to Jul 18, 2026, 16:00 UTC
EN

A Transition Ledger for Debugging a Five-Wave Godot Dungeon Loop

Disclosure: I work with SEELE AI. This article describes a real internal Godot 4.6 Dungeon Master Tycoon prototype; it is not a public playable releas…

architecturegamedevshowdevsystemdesign
Dev.to Jul 18, 2026, 06:51 UTC
EN

Load Balancing: The Neo Way to Dodge Traffic

The Quest Begins (The “Why”) I still remember the night our API started to sputter under a sudden traffic spike. Users were seeing 502 errors, the mon…

systemdesignarchitecturebackendprogramming
Dev.to Jul 15, 2026, 15:50 UTC
EN

Building Reliable Event-Driven Systems: Event Schemas, Versioning, Contract Testing and Events vs Commands (part-2)

This is part-2 of the article series on "Building Reliable Event-Driven Systems". In this article, we're going to explore Event Schemas . 5. Designing…

eventdrivendistributedsystemssystemdesigntutorial
Dev.to Jul 15, 2026, 05:41 UTC
EN

We hit an at-least-once delivery trap. Here is how we fixed the race conditions.

If you are running an event-driven architecture with message queues like Kafka, you already know the drill, scalability is awesome, but network partit…

architecturebackenddistributedsystemssystemdesign
Dev.to Jul 14, 2026, 20:33 UTC
EN

Why Early MVPs Fail Before Launch

Most MVPs do not fail because the first version is too small. They fail because the first version is not focused enough. A real MVP is not just a redu…

webdevarchitecturesystemdesignsoftware
Dev.to Jul 14, 2026, 09:26 UTC
EN

# The Complete TypeScript Mastery Guide

Learn TypeScript From First Principles to Senior/Staff-Level Production Engineering If you searched for how to learn TypeScript properly — not just th…

typescriptwebdevsystemdesigntutorial
Dev.to Jul 10, 2026, 18:33 UTC
EN

Execution Latency in My Polymarket Trading Bot - Sub-Second Trade Execution System Design

Speed on Polymarket is not what I thought it was when I started building this. I assumed faster was always better. Get the signal, fire the order, win…

performanceshowdevsystemdesignweb3
Dev.to Jul 10, 2026, 08:25 UTC
EN

trelix v1.0 to v2.7: When "It Works" Meets "It Scales"

Twelve days after I shipped trelix v1.0.0, I was staring at a RetrievalConfig object with two conflicting sets of values and no idea which one was act…

systemdesignaiengineeringpythonopensource
Dev.to Jul 9, 2026, 19:39 UTC
EN

Architecting 21-Service E-commerce with Golang & DDD

Answer-first: Migrating an e-commerce monolith to 21+ distributed microservices using Golang & DDD. Explore Kratos architecture, Saga patterns, an…

gomicroservicessystemdesigndomaindrivendesign
Dev.to Jul 9, 2026, 13:35 UTC
EN

HTTP/2: The Protocol That Stopped the Connection Explosion

In the previous article , we explored why HTTP/1.1 eventually became a bottleneck. The web had evolved from a collection of simple documents into a pl…

httpsystemdesignnetworkingperformance
Dev.to Jul 5, 2026, 16:30 UTC
EN

Beyond TTL: Explicit Cache Invalidation

Most engineers default to TTL for cache invalidation. But a simple Time-To-Live guarantees stale reads for a duration, which is unacceptable for criti…

cachingsystemdesignbackendengineeringdistributedsystems
Dev.to Jul 5, 2026, 06:04 UTC
EN

Idempotency in Payment APIs — Not Optional, Not Later

There's a version of this story that plays out at almost every fintech startup I've worked with: the team ships a payment API, it works in testing, it…

apibackendfintechsystemdesign
Dev.to Jul 2, 2026, 20:07 UTC
EN

Eventual Consistency Is Misunderstood by Most Engineers

I've interviewed dozens of engineers at the senior level. When I ask them to explain eventual consistency, most recite the textbook answer: "data will…

systemdesigndistributedsystemssoftwareengineeringbackenddevelopment
Dev.to Jun 29, 2026, 21:08 UTC

© Tech News — Headline Aggregator

Sitemap Legal Notice Privacy Terms Copyright / Removal DSA Contact

Leaving the site

You are about to open an external website:

Continue →